DPCstruct | MC38335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 95 ± 15 aa |
| Standard deviation of domain lengths | 14.95 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 31.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7TZM4 | 11-110 | KISAECYEIAKLCDLIIEYIITSKDCSNIVPKIILLSYFPDFKLSERAEKVEIDDSDYPHVIYTKYQIANIYNPKVRFSFENVDIAA… |
| A0A1I8C278 | 196-286 | PKLYDLIINYIATSTDCTKVVDHIVLKFSNDPILKLSDRAVKIRKERQVDFYNITKYQIVNIHNPKVRFSCSNTECDDGSIFWVDIK… |
| A0A6V7VZH0 | 15-100 | None |
| A0A6V7Y6U5 | 161-248 | None |
| A0A6V7TRJ8 | 236-337 | None |
| A0A6V7TS98 | 89-214 | None |
| A0A6V7TX07 | 214-307 | None |
| A0A6V7TXI4 | 200-287 | None |
| A0A6V7U294 | 259-355 | None |
| A0A6V7XDZ2 | 131-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.