DPCstruct | MC38334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 76 ± 12 aa |
| Standard deviation of domain lengths | 12.15 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7TVW9 | 1-80 | MWDKLVESENGSIGIEKSESFYVGDAAGRTKNNNRPKPDHSCVDRLFAMNLGLKFYTPEQFFFPNSSQIEEDFLLPKFNM |
| A0A287LIX3 | 1-55 | MWWLMAEHFNSGIDIDMEQSFYVGDAAGRENDHSDADIKFAKAIGLKFHVPEEYF |
| A0A4U6UK79 | 569-632 | None |
| A0A5S6QDI9 | 984-1057 | None |
| A0A146F6D8 | 17-108 | None |
| W4GG15 | 43-103 | None |
| M4CBJ2 | 395-460 | None |
| R1FWR6 | 150-227 | None |
| A0A3D8QUD4 | 113-200 | None |
| A0A2P5XGT3 | 239-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.