DPCstruct | MC38331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 224 ± 23 aa |
| Standard deviation of domain lengths | 23.22 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 26.99 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0159- PF01682 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A016TTQ9 | 39-285 | TQLHCVLNTCSPNVVWSKDEVMIFNGTSFVKSPSIDEKSFKLHHKVEVDFEKGCTSQCDDSTPCPEGSSCVDNQCCTCSKEEFTLIL… |
| A0A6V7TM92 | 1-183 | MISWHHDGILLFNGTEFEPTSGIEPSRIILQRSLEEINNDEEMKGEKCFIEAYSLLLRNLSLEDSGKYGCQLWTQNGGQQQLDFKLD… |
| A0A0P4VZR4 | 56-256 | None |
| A0A1I8BV52 | 67-276 | None |
| A0A0B2UXC5 | 9-238 | None |
| A0A0K0EB61 | 40-270 | None |
| A0A1I8CTN4 | 169-385 | None |
| A0A0N4U846 | 234-455 | None |
| A0A443S6Q5 | 1-209 | None |
| A0A6P4H4D9 | 2-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.