DPCstruct | MC38330
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 339 ± 42 aa |
| Standard deviation of domain lengths | 42.26 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 23.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7V5N6 | 101-419 | KPSFKVGLGDHILQGRRVTLANGSMVVKNEDVEHYMTSSANACDVDFDDEGNIVLHYTNLEATKDKGCTMDLLTNLRHEIVFWTGVH… |
| A0A6V7TJY9 | 1-351 | MIRDRVAALLIILLAIWASLNCVMSEEVTYVGYGRHTMVNNIITKIGTARRIAKTNEDLEDYKGTENACDVKFDENGDIVLNYNSVR… |
| A0A1I8C024 | 15-378 | None |
| A0A6V7XW05 | 37-315 | None |
| A0A6V7WJ84 | 223-589 | None |
| A0A6V7WH81 | 17-287 | None |
| A0A6V7WH48 | 2-378 | None |
| A0A6V7W956 | 1-284 | None |
| A0A6V7U932 | 12-408 | None |
| A0A6V7YAA9 | 2-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.