DPCstruct | MC3832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 174 ± 23 aa |
| Standard deviation of domain lengths | 22.58 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 25.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842Z0S9 | 123-277 | YILETDDTWGTGDSKVDADEPNDAAFQFVVMTSPEELQLSLDKRDGSHWSLFNCNDAVSEEPQTIQMVCTDVSKDSNCHKISLGHGV… |
| A0A0W0EY68 | 18-203 | QVYGANDWNTPCLNGVCQYSITSTNGGSSGTLKIWGSNAAISDITSAAGWEILDCSPDKLAQDIRLVCGSEDTEGAGCSHLYEEGAE… |
| A0A1L9PNC0 | 236-453 | None |
| A0A0H2RYR4 | 25-187 | None |
| A0A0H2SKE3 | 6-172 | None |
| A0A365MKJ0 | 4-190 | None |
| A0A395T2J0 | 4-119 | None |
| H0EHY9 | 479-669 | None |
| A0A1L9VE00 | 11-201 | None |
| A0A2H4STL6 | 550-705 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.