DPCstruct | MC38317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 171 ± 9 aa |
| Standard deviation of domain lengths | 8.75 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U3R455 | 89-256 | VRENRNRHDKGSLEEKFWKEIGNSLYGKLAQGLHAKTAFDTARGLNSPLPPSSVTQPFFAAHVTGFVRAVVGELMNALPPNATVVSV… |
| A0A2W5SWJ2 | 1-167 | MVVDRDVAKQTFGKGSLAELLIKVATNSCYGKLAQDVAEQNGWDAWREEMEAVGGSAVTSPHQANMITSLVRSSLLAVANSVDILSV… |
| C7N837 | 775-955 | None |
| F7QTX4 | 309-476 | None |
| A0A2E6E8J3 | 75-229 | None |
| A0A0S2KPC8 | 99-285 | None |
| A0A1Y2UG14 | 713-891 | None |
| A0A7G7YDW2 | 1-164 | None |
| A0A415JSD8 | 554-722 | None |
| A0A812GNA7 | 216-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.