DPCstruct | MC38316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 417 ± 42 aa |
| Standard deviation of domain lengths | 41.61 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 13.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N6TBP3 | 13-422 | DSADPLLGWASTTELELSRQLSDLDFAVEVNLSGDELERLDRFWGRFVTRQISAGAELSAVLEACPAIVATTLVGRAGRIADLSNFD… |
| A8LN11 | 5-343 | PDRLQALFRGFPSLAAWLVTHSLSEGYGDAGNAVYPHIADVLQVPLDFQPHRKVLFRSFCAVCDRFGLPTRGLDRDVDVYLLHAGVS… |
| A0A285GBH1 | 8-463 | None |
| A0A841DG82 | 1-398 | None |
| R9KZI3 | 347-748 | None |
| A0A061AA53 | 76-525 | None |
| A0A1H7HRU3 | 3-454 | None |
| A0A1V4QHJ3 | 3-505 | None |
| A0A4R7E2C3 | 1-440 | None |
| A0A6P1M8N7 | 1-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.