DPCstruct | MC3831
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 346 ± 57 aa |
| Standard deviation of domain lengths | 56.83 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 65.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V2XBH6 | 2-249 | SHIEASESQTSYPAITRDDSKDCLLDVQKHEESSRYLAQFKFTPKWKIVTSLVFGTLVLFGGIALTAVLIDREKGLHHLSATSGGNG… |
| A0A0W0EWW1 | 1-349 | MAHQSQPSDHIYNRIPLEQHPPSPGPGSTFQNPHSRFAGQALYQDGSYATSHQSMPSIGGNSEYSASVYALNDTRDNPSLSGHYRDD… |
| A0A1C7MGX5 | 1-396 | None |
| A0A5N5NHM5 | 1-388 | None |
| A0A1C7LP29 | 1-330 | None |
| A0A0E9NAJ4 | 398-789 | None |
| A0A146H4H3 | 322-646 | None |
| A0A4Q2DVY4 | 7-237 | None |
| A0A0W0FBP2 | 1-352 | None |
| G7DZ35 | 317-695 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.