DPCstruct | MC38306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 125 ± 17 aa |
| Standard deviation of domain lengths | 16.75 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20862 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C8LIN9 | 4-130 | VVIFLILFVTLFGIAGVYTAIKSPEHHKYIVPDGYTGWVKVTFDQAGYPPLEKKYRTYLYAVPANGQLVTSSRMKAGSMQVFYLGND… |
| A0A1L8ZQD1 | 2-108 | KTKIGIAVLVLIFLGVMYKFLVDQEGVDQTYLLPSGFEGCVVIHYNVDGAKPLKIENNEIVYKVPESGILYTSSTSDFGWVNEKHSG… |
| A0A4R6TJC5 | 2-130 | None |
| A0A330LUS7 | 1-120 | None |
| A0A1I1EAM4 | 29-162 | None |
| A0A2R7KNC0 | 3-98 | None |
| Q39LK9 | 2-97 | None |
| A0A1Q3XBS0 | 2-120 | None |
| A0A519SHS4 | 3-133 | None |
| A0A2A2FA93 | 14-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.