DPCstruct | MC38305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 96 ± 18 aa |
| Standard deviation of domain lengths | 17.51 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E3ZP94 | 16-107 | CYLNSTSNLYVVTNPLINELKECEIQDLFEENVLKTELNGKIFEKSEKDFIDTRNYGKRALSKYVWNNYDNINFENFRPLLDAIDQI… |
| A0A4P6ZX50 | 81-178 | KKSNLESDYMVGIIDNLYLLTVPLIDGKPECDIEDLFESKTLSHKINGKTFSKNDTYDTSKHYGKEIYSKYILNNYADINFKEFRLV… |
| A0A6I1KHE2 | 44-134 | None |
| H2FV69 | 1-70 | None |
| A0A6L6TQL7 | 457-561 | None |
| A0A414JWP8 | 3-144 | None |
| G5JYK5 | 199-305 | None |
| A0A7H1NQK7 | 112-197 | None |
| A0A3R9Q1M2 | 12-128 | None |
| A0A7Z6UUS8 | 405-499 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.