DPCstruct | MC38304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 88 ± 15 aa |
| Standard deviation of domain lengths | 15.06 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4SAJ4 | 7-69 | PRNDGDLSLWIDQHQVKMFSGFSMEIYAIVDGRVLPYILDPNFEEYLPVIPSEVGYVNFTWKS |
| A0A1Y1LWI0 | 7-106 | ASCQVFVILILLVNAIPRHNRNDHKNDPRNNGDLALWIDEKQVKMFSGMAMEIYAIVNGNVLPYILDPNFEKYLPVIPAEVGYVNFT… |
| A0A6A7FZC8 | 29-109 | None |
| A0A2A3E6Z1 | 8-94 | None |
| A0A6J2G7L9 | 95-189 | None |
| A0A1S0TJH5 | 3-76 | None |
| A0A1I7WA70 | 2-73 | None |
| A0A6J0WWI7 | 1-93 | None |
| A0A2P8YFM9 | 2-90 | None |
| A0A060Z7W4 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.