DPCstruct | MC38301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 169 ± 24 aa |
| Standard deviation of domain lengths | 24.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9M0I7 | 42-209 | NGIGIEKILQTTYINAACVLKHESQLWLAAIHRRLAGRRSVRHPYYAEFYRDIPVDLFTALSHSIKVSNDPKLGEPMCYIKGNSKGE… |
| A0A1Y1LN91 | 4-150 | IDWLSSTTERINQCITNNKKEGLQVLQSYIPLSFFVLLQARIHQDEKQHNFYTCTDSTGITYIIRNTAYLKKVFDTPQISLQLVQVH… |
| A0A2B4RCY8 | 41-227 | None |
| A0A2H3ERV2 | 45-254 | None |
| A0A3Q0ITF3 | 132-314 | None |
| A0A2B4SRC8 | 300-448 | None |
| A0A182F6F0 | 503-696 | None |
| A0A7S2UI01 | 54-235 | None |
| A0A6P8I7Q4 | 148-299 | None |
| A0A6S7I5C7 | 43-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.