DPCstruct | MC383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 8.13 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13448 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4W3P3 | 1-81 | MESDRAFGWYLIPNGTTEQFLRENPDNLLGNSPLAFFSFIAANPNGIDNFWRLSPNEFAWTDLTNDSDIDFNDVMIGIQFG |
| T2J3H6 | 98-167 | FMIADGTPESFLADNVNNDPTLGPIAYFEDRFANPDGVDHIIGIDSNTLGFEEFYNGGDHDFNDAVAMIN |
| K9RCA6 | 31-117 | None |
| A0A1Z4KC88 | 1-93 | None |
| A0A1Z4LHZ8 | 18-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.