DPCstruct | MC38293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 146 ± 24 aa |
| Standard deviation of domain lengths | 23.89 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T1DFV4 | 1-150 | NILKKSSTTNGKVSQKSYKEKEDTTGMTLQKSASERASKKITLQNRTEQPREVIPTAVIPGSTKLSRRNSPFTTNFDRLVPFRTLTG… |
| A0A6D0FAK4 | 40-186 | ILTLAPETNGQVAVKAWAALSEFTGRDHTHLALNKEDEKIRFRDIQAQPRKIISSPTWSGLEDEHVSYNAGYTNVHELIPWRTLSGR… |
| S7SSX3 | 398-556 | None |
| A0A1V3WFN9 | 5-152 | None |
| A0A7C5L3H1 | 305-467 | None |
| A0A017HEE1 | 501-645 | None |
| A0A1Z1WSB6 | 288-443 | None |
| A0A014M4M6 | 176-307 | None |
| A0A7V0PM57 | 345-502 | None |
| A0A2X3CHN9 | 279-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.