DPCstruct | MC3829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 76 ± 13 aa |
| Standard deviation of domain lengths | 12.58 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 53.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0DR68 | 17-90 | AERFMKQVRRNTRRKFTAEEKIRVVLEGMKREIPVSELCRREGIASAVYYVWLKDFMEAGKARMKGDSLREASR |
| A0A7C7G9R3 | 14-82 | ERSQDAQRFVRRVQSATRREYTAEEKIYVVLESFRREVTVNELCRREGIKPKNFYSCTKEFMEAGKRRL |
| A0A523JZU5 | 6-83 | None |
| A0A840YMB8 | 4-68 | None |
| A0A1I1NM56 | 9-84 | None |
| A0A660V5E0 | 2-58 | None |
| A0A0E1WW41 | 3-85 | None |
| A0A5P9HWR3 | 1-64 | None |
| A0A3B0RPP8 | 3-71 | None |
| A0A2E5YNC9 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.