DPCstruct | MC38288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 173 ± 17 aa |
| Standard deviation of domain lengths | 17.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19498 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9J689 | 25-212 | SGSTQEYLNGLKEKYPDVNITVADFKNGKQEDAYMFGSSGGNNMVIASNIIEKMASDPATAAKYEKYIAEVPEAAGIMKDGIEAHGN… |
| A0A175A882 | 25-180 | YSNVNDYSKYLQGKYHYVNTGTTSMQGVPTTVSVSSAFLQKCMNDPEKAKYLEENLAAIPDCAKSAVNGCLGTLTNLSYKVDENGNI… |
| A0A1C5RPF0 | 15-169 | None |
| A0A3A3G9E6 | 45-218 | None |
| A0A3D8IGR0 | 1-157 | None |
| A0A3A9GKQ5 | 1-204 | None |
| A0A7U9NAU4 | 2-149 | None |
| A0A3B9WS62 | 57-222 | None |
| A0A413YPZ8 | 2-190 | None |
| A0A4U8SJ15 | 1-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.