DPCstruct | MC38284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 5.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0116 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B9A0X9 | 20-76 | LHPALKSVSELIGTWRGTGRGEYPTIDAFEYTEQVTFAEAGKPFLVYVQKTWSPERA |
| A0A6J6S3K8 | 7-68 | NLHPDCGPVAWLLGHWVGNGKGDYPTIEGFEYGQELVFQQDGRPFFHYFARSWIVDAEGEKV |
| A0A540K6C2 | 8-72 | None |
| A0A8B6FAP7 | 1-66 | None |
| A0A7S4KFL7 | 51-115 | None |
| A0A2P7AGS9 | 3-62 | None |
| A0A7R9A4R8 | 1-65 | None |
| A0A165YAQ9 | 6-72 | None |
| A0A7J0G4W9 | 10-77 | None |
| A0A5D3B923 | 16-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.