DPCstruct | MC38283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 259 ± 36 aa |
| Standard deviation of domain lengths | 36.01 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5NAU5 | 32-288 | AQVTSDLKEARDEEARQKGELNHRRRSIFRWFYKKRIAELEEALPVTQGEIERLKNWEGNTKIAVTFVAEEAAQRAYSSMVRAFDSL… |
| A0A7W7EHG5 | 18-284 | GEVLDEINAKANQWRLSALFGWLAALLGILVLAKAPPVGIWVLIAALPAWAIGSWLDSYRRSTVLFYDIDGPVEQAYKETIAAFDDL… |
| A0A810L5P2 | 16-277 | None |
| A0A7L9BIY1 | 8-225 | None |
| A0A2E2DKR4 | 22-287 | None |
| A0A1M6RZF3 | 58-337 | None |
| A0A7J9ZY29 | 129-422 | None |
| A0A4R2V280 | 16-235 | None |
| A0A7J0A812 | 81-397 | None |
| A0A560MBR7 | 56-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.