DPCstruct | MC3828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 104 ± 10 aa |
| Standard deviation of domain lengths | 9.83 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A7KJ76 | 2-100 | KIRYCWRCKMDVPMLDSEEGKIASKLLTEGFQEAVKQRKAPDFRKLLDYYKEITGYEETNHNAIMHHFIDMYGPDCENCGKPYRTET… |
| A0A1M7GCU7 | 41-144 | MKNLWCWRCKMEVPMLNTEEYLTASKLYRSGFEKGKCNMTRTQRFKELLDYYYELTGVKLTNPNAIMHHRIDLYGPPCENCSKPYRT… |
| A0A846VAI7 | 1-85 | None |
| A0A545TYL1 | 15-128 | None |
| A0A545TPC9 | 3-115 | None |
| A0A1S1J4J5 | 2-111 | None |
| A0A1H3NEU3 | 2-113 | None |
| A0A2V9C0F0 | 1-83 | None |
| A0A518DZQ8 | 1-111 | None |
| A0A4R2VU14 | 2-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.