DPCstruct | MC38275
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 112 ± 14 aa |
| Standard deviation of domain lengths | 14.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L7UWF5 | 13-126 | SVCLEHGKAEPNSGMTYRISKVEDFNENPILAETLKMVATGQIDPQAGQAATWHITDNMSWEQLAAKSTPHVGRSATPYFSAETLAR… |
| A0A3L7QKT9 | 1-87 | MNYTIVRPDKYSSDPRVHEVCKLVGTGKIDRATAQAAAWHVCNNMSWEQLAQKMYNHVGSPDTPYFSRSQLMAAQSMVAAVDVRVAE |
| A0A518ARR2 | 181-284 | None |
| A0A5C5ZM68 | 189-311 | None |
| A0A832FX20 | 3-95 | None |
| A0A7V4HVZ2 | 31-158 | None |
| A0A2E8FIT4 | 22-140 | None |
| A0A1G3AAK0 | 15-128 | None |
| A0A5C6F9X3 | 150-254 | None |
| A0A2E0S6J6 | 16-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.