DPCstruct | MC38274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 102 ± 14 aa |
| Standard deviation of domain lengths | 13.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 51.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0291 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A4NX35 | 3-82 | NEWNLVFGKTLGHAERSLISELREIRKQWAHQEPFSTDDTCRALDSAARLLHAVTAAGEAQEVDRMKQEILRIRFDEQAR |
| A0A2S6NBS9 | 62-152 | AGLLKLTWDTWNAVFAPTLGRVERFLVQEVRDWRNKWAHQVPFSGDDTDRALDSITRLLTAVSAPQSDYVHRMKMERRRLIFDEKAR… |
| D8G617 | 60-176 | None |
| G8N7R1 | 52-162 | None |
| A0A1U7INZ5 | 53-168 | None |
| A0A7C1KIC0 | 59-153 | None |
| A0A5C5X8G3 | 238-325 | None |
| A0A3B8Q2F3 | 60-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.