DPCstruct | MC38266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 168 ± 23 aa |
| Standard deviation of domain lengths | 23.10 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A520I2N1 | 2-158 | RKVGITVGALDLFDARLLKPESARWRRILAAARGTTIAAPRDGATVLTRGSEGAVLEAGFRPLGLQAVRIDLIERIARAAHDSRQGR… |
| A0A258BUU2 | 36-162 | RKAGFTIGVLDIYHHALLKPGAALWRLALSAVKRAKPMLPLPQAGAVLLTLKDREEQMGARHAGYRGFGDAQIRIDMVERIARGGHE… |
| A0A845RWR7 | 157-315 | None |
| A0A1F3B7R7 | 124-315 | None |
| A4EU28 | 64-234 | None |
| A0A1M3A7Z7 | 26-198 | None |
| A0A024KC40 | 8-191 | None |
| A0A7V4P8A0 | 258-451 | None |
| A0A356THX8 | 1-115 | None |
| A0A259CFS9 | 61-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.