DPCstruct | MC38260
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 117 ± 13 aa |
| Standard deviation of domain lengths | 13.43 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12401 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5DAY6 | 13-113 | PRYIEKRMCRAIDEGARVFLKKVYAPNYITVCLNPEDMREVFKYRRVFWDEMRRTAQEHIEANLSLAGNIGDRIVIKILDDPAVPKG… |
| A0A538K396 | 14-116 | FEGIFGRAFRTNVQPVELARKLAKEMDDHRTVSVSRVYVPNEYTVYLSSADREQFVGYEDNLKGELQEYLSEHARREDYALLSPARV… |
| A0A7C2ZVA4 | 5-113 | None |
| E3J3H5 | 15-135 | None |
| A0A3E0NWM8 | 110-255 | None |
| A0A4R1CTE7 | 15-129 | None |
| C7N2Z4 | 12-130 | None |
| A0A4R6UM54 | 97-210 | None |
| A0A3A0G5D8 | 117-234 | None |
| A0A1Y2N1C0 | 2-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.