DPCstruct | MC3826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 6.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3F215 | 5-83 | DWSCAGCGVDTDNVDGRGHDEYYMLHHDLWLAINPNDAGHLCIGCVESRLGRRLIRADFTDAPVNTNPRRATARLTSRL |
| A0A5A7W9Y1 | 8-85 | DGKCMDCRTEVTFITPDEYYMVHDDLWLSANPTGDGKLCVGCFEVRIGRRLEPKDFIDAPVNRRFAAMSDRLKSRVVG |
| A0A538JJR6 | 1-78 | None |
| A0A1M5TY57 | 17-92 | None |
| G7GZW2 | 92-161 | None |
| A0A286DYB3 | 26-108 | None |
| K0F6I1 | 1-67 | None |
| A0A497BAC2 | 5-74 | None |
| A0A6A7KTF3 | 23-90 | None |
| A0A3D9WZR4 | 95-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.