DPCstruct | MC38256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 108 ± 14 aa |
| Standard deviation of domain lengths | 14.02 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01314 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4M890 | 8-117 | GGIELKWGDPDVIIRMVELIGRREGFGAILEEGSMRAAEKIGRDAERYAMHVRGLEIPMHSPYRFKEMGLQYAISERGLSFKRAFML… |
| A0A0P9DSX5 | 91-189 | TAYRIGFGNDIALGAKRLAEKYGAPEIAMHVKGLELPAYDPRGAKGYGLAYATSNRGGCHLRAYMIAPEILGIPEKLDPLKTEGKAS… |
| A0A7Y5HEF9 | 160-265 | None |
| A0A7V0YUL2 | 5-124 | None |
| A0A2A5NY80 | 18-107 | None |
| A0A6B0DHU3 | 29-159 | None |
| A0A6J4XVS5 | 22-147 | None |
| A0A5K8AHJ6 | 1-97 | None |
| A0A6V8PH98 | 123-240 | None |
| A0A6V8NUF4 | 29-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.