DPCstruct | MC38252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 127 ± 14 aa |
| Standard deviation of domain lengths | 13.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01886 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6C5E8 | 10-128 | NDGVVADRRRLSDLVMELHPASITRGGREYAFNKNTIRVLWERLPESLRYRLKLPILFYFDSTVTDSFMLADATALEALQSLGELSD… |
| A0A7C4GEC1 | 10-151 | NVKIDRLLNFIYKSDIEKLNDHLPTEFKSLKDIASNNSYTIKSRNGLDIIIDRNEINLLCNLLPSDLHDKLMLPIIFLRRIDLGRGI… |
| A0A662TXU2 | 7-147 | None |
| A0A2P6VYI5 | 89-226 | None |
| A0A7J3XUW7 | 3-127 | None |
| A0A2J6N6I7 | 1-103 | None |
| A0A7C5LCQ6 | 27-167 | None |
| A0A7J3APA9 | 59-185 | None |
| A0A656YWD3 | 2-104 | None |
| A0A2R6T5Q6 | 4-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.