DPCstruct | MC38251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 397 ± 77 aa |
| Standard deviation of domain lengths | 77.06 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 69.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.88 |
| Pfam Score | 72.55 |
| Assigned Pfam label(s) | PF19438- PF10165- PF06584 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182JN49 | 18-359 | EWFYSDIDRALFADGSDLDYEFAALVNHHFPGLKNQPLNRAQLNHVRRRLRQLGRGPGRRRCSPAFFYAERVRLEERREKIRMLQEY… |
| A0A4W3JYJ9 | 63-486 | IVETKFSAGMGTPDKKAAQKIGLRLRNLLKLPKAHKWCIYEWFYSNVDKPLFEGDNDFCVCLKESFPNLKTRKLTRVEWGKIRRLMG… |
| B4I9L3 | 1-444 | None |
| A0A0V0Q8D7 | 1-401 | None |
| A0A6S7NHF2 | 666-1206 | None |
| A0A5B8MJH5 | 381-862 | None |
| A0A2A2KNI0 | 136-583 | None |
| A0A815K1Q8 | 34-364 | None |
| A0A1I8HMW5 | 4-438 | None |
| A0A7J7J9H7 | 2-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.