DPCstruct | MC38248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 377 |
|---|---|
| Mean domain length (aa) | 184 ± 33 aa |
| Standard deviation of domain lengths | 32.50 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 13.29 |
| Pfam Score | 95.42 |
| Assigned Pfam label(s) | CL0616- PF14774- PF12480- CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G7K0L5 | 60-218 | MTDSETDDSITSEDDFKARPILDANWSGNLRFGDNTINGLMAHLSDLVCPKVWKETELLPDVLSADLLPRSEVWPDSFKKDGPTNKN… |
| A0A7S2ZYW3 | 263-385 | NRPRWKCRLQKTGKFICNLNAHQIRGPGLGDQGLPYTLVVERRFSLLHLNQFVLPEATMLYFEPVTPEDRPGFEQFIDYLVKRSRAG… |
| A0A0D2YC79 | 439-611 | None |
| A0A022QVB7 | 48-210 | None |
| A0A7N2KU71 | 526-715 | None |
| A0A2G8LCN3 | 185-397 | None |
| A0A836J218 | 100-334 | None |
| A0A4U0VIP5 | 375-612 | None |
| A0A5N5TK55 | 1-129 | None |
| A0A7M5TYE7 | 650-876 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.