DPCstruct | MC38242
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 168 ± 36 aa |
| Standard deviation of domain lengths | 35.98 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 71.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2JSF3 | 4-210 | SFLLAIILTAATTIPINAVTCPDGENQMSVEGVEGIFCVAGDPCIATFSTGACPAAQEGLPYGSYCGVVASGVYGCKTYTSAATEIP… |
| A0A662YL29 | 2-130 | SVQGISAVFCVASEGCAGTNSTGVCPEAQAGLEFGSYCDLLETGVFGCKPFIDDIGTRDNVTYAAPLDCTGNIAGEFPVSVENTNSS… |
| K3W958 | 172-325 | None |
| K3W956 | 341-510 | None |
| K3WKJ8 | 314-467 | None |
| K3WKK8 | 61-290 | None |
| A0A024URM6 | 325-559 | None |
| A0A421G0M3 | 43-190 | None |
| A0A024UCQ9 | 41-220 | None |
| A0A081AZE9 | 1-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.