DPCstruct | MC38240
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 172 ± 19 aa |
| Standard deviation of domain lengths | 19.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2IQA3 | 1-174 | MESITLSSADLVLIDVQRSSQLSPELIVLTKFTLDRLATNTYQIYDLDAAKSPQTNEHSLPRHAAHISTLSSNAQICVSRIKGQVAK… |
| A0A6A3HXG4 | 309-457 | EAVTESLAELARIEVQRSNQVASELIVLLKFAIDRLGADSYNIYDMDALRSPKTNEKTLPRRSIHLSALSAEGQICVARIKGQVEKR… |
| A0A225WA01 | 277-474 | None |
| A0A2P4X193 | 73-263 | None |
| A0A0W8CEW5 | 154-343 | None |
| D0NGG7 | 623-765 | None |
| W2LR70 | 2-197 | None |
| A0A2P4YMQ2 | 195-393 | None |
| A0A329S4B2 | 1-153 | None |
| A0A329SA41 | 1-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.