DPCstruct | MC3824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 4.52 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 48.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M2FQB1 | 48-117 | FDKQKFLFPISSYRGPFTPQNLAFNANLQEFAQRVNYICGLETGGKITSDEAYNQIKALWKQLKKSRELL |
| A0A2C6W3T5 | 2-72 | TQLNYEAKKNFLYPYSRYYGVITPNNLIFNANLQEFAQKVGYISSLETNGKLSPEEALRKIELLWQQLKAS |
| A0A251W8J4 | 30-108 | None |
| A0A3C0N6A5 | 2-78 | None |
| A0A0P7ZGV8 | 4-74 | None |
| A0A0M1JU47 | 1-73 | None |
| A0A0X8WUN3 | 3-79 | None |
| A0A1Z4LDA1 | 5-78 | None |
| Q10WQ9 | 31-110 | None |
| A0A480AD46 | 27-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.