DPCstruct | MC38234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 111 ± 17 aa |
| Standard deviation of domain lengths | 16.59 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.01 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | PF04825- CL0163- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8D7M0 | 3-98 | DHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFILLECPHVYFCGSAPRFGSKVIRGPEGQTVLLVAVPDFSATQTACLVNLRHLA… |
| A0A183P510 | 226-340 | NACDRMEATLLWGHLAPTCPDTLGGYPMTNVDPLLLRSSSTSSAQNFSPDYPDIYIAGCQSEDQPSWRRARLKWSEEIDKNNCGCLL… |
| S9U1W3 | 142-293 | None |
| S9XJ54 | 1007-1162 | None |
| B4H436 | 145-222 | None |
| A0A183X302 | 2-101 | None |
| A0A7S3PS82 | 78-203 | None |
| K5W932 | 392-488 | None |
| I1CM34 | 402-498 | None |
| A0A835GTC5 | 277-379 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.