DPCstruct | MC38233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 122 ± 15 aa |
| Standard deviation of domain lengths | 15.13 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0171 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8IJQ6 | 308-417 | GAGYKLLCVIDRLCSAYVLSKDNTYRWDTCAPHAILKALGGGVVQFKGLLASDLSPGKRDQSLREQQITYHKSEPKANGSNAWCNAQ… |
| A0A183NYU2 | 1-148 | YKDANQDLVNVVFLSSSGAGFKQLCVILDQVDAFILMEPNTFIWDTCGPHTIINSLGGGIIQLKYALNSIKLLLLQKQLSNNYNLII… |
| A0A183LUW9 | 90-237 | None |
| A0A482UCF9 | 25-147 | None |
| A0A3R7M2Z0 | 269-394 | None |
| A0A814LYI6 | 633-742 | None |
| A0A813WX23 | 770-889 | None |
| A0A821YMC7 | 1-110 | None |
| A0A813QR44 | 285-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.