DPCstruct | MC38232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 285 ± 33 aa |
| Standard deviation of domain lengths | 32.53 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.19 |
| Pfam Score | 87.26 |
| Assigned Pfam label(s) | CL0023- CL0220- PF08355 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183NUX0 | 3-307 | NLSETFWFAQKAVLYPTAPLYNAEKKELTPECIRALIRIFRICDTDNDGYLSDRELEAFQTRCFSIPLTAQSLHDVKQLVKQSCPGG… |
| A0A672KYU0 | 43-349 | MNQYSEIETCVECSAKNLKNISELFYYAQKAVLHPTGPLYSPEEKEMKPSCIKALTRIFKISDLDNDGILNDNELNFFQRTCFNIPL… |
| A0A1I7RQ06 | 154-458 | None |
| A0A7J7T397 | 8-313 | None |
| A0A674GTT4 | 478-784 | None |
| A0A438N6T3 | 137-449 | None |
| A0A178EUM6 | 138-450 | None |
| A0A5B8N2Q2 | 148-452 | None |
| B7PAT4 | 126-432 | None |
| A0A409VGM4 | 169-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.