DPCstruct | MC3823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 90 ± 6 aa |
| Standard deviation of domain lengths | 6.20 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L9ZY10 | 6-96 | GDLVREKASFEIFGSQQFIDWLNTEKLSLAFTTYQSNRLFFIGIKPDGSLSATMRTFDRPMGLYATADRLTLATRYQVWQLENMVEK… |
| A0A1I1UKM3 | 10-87 | SRHFPGLLAELGVSLAFTTYQAGKLFLLGSGYGGRLSLFERTFARCMGLCVDGESLWLATLYQLWRLDNALPSGQVHE |
| A0A367QFP0 | 1-84 | None |
| B5IQK8 | 248-348 | None |
| A0A068MVK2 | 2-89 | None |
| A0A2T1LSX1 | 2-86 | None |
| A0A841WQK2 | 7-100 | None |
| A0A5A5RCN9 | 4-96 | None |
| A0A6M0J6A7 | 9-103 | None |
| T2IF30 | 5-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.