DPCstruct | MC38228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 97 ± 17 aa |
| Standard deviation of domain lengths | 17.44 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05427 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444T4A5 | 61-158 | YYSFDGSVIREILGKKLSGRTRKDLDDVAEKTGITLRSCRRQFDNVKRIYKQTDDASGSVKLNIQASFLLPPALAQKYATVVFLTSN… |
| A0A183NLG5 | 1-121 | YYSLDESFLREFVGRRLSNKSRRELSDIAERCELQLRSCKRQFDNLSCVARRTEDLPGPLTDNIKNCFLLPEWLAECYAAVIFIASN… |
| A0A674GYR3 | 267-359 | None |
| A0A3P7M0X7 | 30-117 | None |
| F4WM87 | 93-177 | None |
| A0A0W8CB53 | 2-91 | None |
| A0A183KQJ6 | 60-190 | None |
| A0A1S3I7Q2 | 4-90 | None |
| A0A0V1BMN1 | 86-172 | None |
| A0A183SNK3 | 99-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.