DPCstruct | MC38226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 175 ± 15 aa |
| Standard deviation of domain lengths | 15.12 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 54.57 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF05076- PF12470 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3HXX0 | 96-266 | SRIQHMLLTEDPQMQPVQTPFGVVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPVAGGPWLITDMRRGETIFEIDPHLQQERVDK… |
| A0A212CPB6 | 1-165 | MLLTEDPQMHPVQTPFGVVTFLQIVGVCTEELHAAQQWNGQGILELLRTVPVAGGPWLITDMRRGETIFEIDPHLQERVDKGIETDG… |
| A0A812C0U5 | 175-346 | None |
| A0A3Q7WHB9 | 100-283 | None |
| A0A7E6FMU1 | 228-383 | None |
| A0A670I337 | 360-559 | None |
| A0A7J7UYI4 | 172-371 | None |
| A0A0T6BEV7 | 32-194 | None |
| A0A2A4J0B1 | 652-809 | None |
| A0A7J8DRZ9 | 71-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.