DPCstruct | MC38224
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 74 ± 3 aa |
| Standard deviation of domain lengths | 3.33 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 94.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 45.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183NHK0 | 1-80 | LCRGIVSSLDVTNILKIQGYWASYNLPFIDDIYILSGTKNMAKMHGDWYVHNMTSRAKIFRRDHHKVVDFPSMMSLMRQV |
| A0A6P7UYR5 | 116-190 | NITKAEDVSAYLQNQKYWGSYNVAFFPAIFNISGQPDMVKKYGNYYSYDMSPRAQIFRREQSKVEDVDTMLRLMR |
| S4P6H1 | 37-105 | None |
| A0A0B1SQL5 | 1-68 | None |
| A0A6G0TWX0 | 375-449 | None |
| A0A1L8HPY6 | 102-181 | None |
| J9EKK4 | 125-198 | None |
| A0A6G0YAL5 | 64-138 | None |
| A0A2D4KS15 | 85-159 | None |
| A0A7M3RLT1 | 163-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.