DPCstruct | MC38223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 94 ± 10 aa |
| Standard deviation of domain lengths | 9.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 54.43 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | PF05076- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812C0U5 | 25-100 | EHAGLVAIDKACSQLYPDQPCPLQATAFVKFWLGGPDPLDYISMYSNNGDHDRNIPPHWHYITFGFSDLHGDDRVH |
| A0A183NGB9 | 1-104 | MSNSAFGPVLSSGTAPNLGSVPSAKEEHALGLKAIYAACRLLYPDQPTPLQVTAVRKFWMGGPDPLDFINMYANPGSAELQSPPHWH… |
| A0A6H5GEU3 | 206-299 | None |
| A0A068YFJ5 | 4-104 | None |
| A0A131YLS7 | 1-96 | None |
| A0A7E6FMU1 | 70-152 | None |
| A0A3R9J6C1 | 9-98 | None |
| A0A670I337 | 194-294 | None |
| A0A813ZAQ0 | 1-82 | None |
| A0A7J7UYI4 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.