DPCstruct | MC38222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 175 ± 22 aa |
| Standard deviation of domain lengths | 21.98 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11707 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3TBA8 | 211-388 | LLNGCFTDKTENVLLILNLLRKSVCENVTVSKTIKMRIFTRNVLKQLGYLYAYRGEALSEKAALARTDAEVDIQTVELVRESVHSLL… |
| A0A183NGU4 | 1-204 | LVNFVESINNEDVDELVVDVVAGGNVVQILKFLDSGQDRKAGEVAENSSVSKTQRVRVFNRHCLQKLTSLYMWRGEGKTVDEVLRKD… |
| A0A7J7KTZ9 | 213-378 | None |
| D4A7S4 | 240-403 | None |
| T1GRC4 | 39-254 | None |
| A0A2P8XKD3 | 72-244 | None |
| A0A183W8V1 | 85-259 | None |
| A0A6J1PPX4 | 2-139 | None |
| A0A6L2PSZ6 | 195-379 | None |
| A0A6J1WAC1 | 1-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.