DPCstruct | MC38221
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 263 ± 42 aa |
| Standard deviation of domain lengths | 41.65 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 65.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.24 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07808 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183NE21 | 4-270 | TPKSDRIRQDPSQTIHRSKHKISHRRHHVRSKKDAQKSDVSESTHRYRDRAKERRDEHEMENDDDTLTRTADYRAVAPSSAAGASHA… |
| A0A3P7MKU1 | 7-242 | EKSEFNEEESNLKEIMKNYRDRALERRLKGNDDNDEIVKLAAAYRAMPGDARAVTDKANLRRQVIEESKYLGGDMEHTHLVKGLDYS… |
| R7T6V5 | 42-319 | None |
| A4RVN9 | 1-299 | None |
| T1KPJ1 | 29-303 | None |
| A0A646QG64 | 20-308 | None |
| A8JBA4 | 68-256 | None |
| S4RST7 | 21-316 | None |
| A0A0L7L113 | 26-225 | None |
| A0A7J6ZKB4 | 24-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.