DPCstruct | MC38220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 4.45 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 54.92 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0123- PF18098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183NE31 | 1-63 | LSKLVVNKTIYAKIDRLEGVVHFIAKKVPTEVLNDWSYNTRNLMALINQTTHLINKERMIHGV |
| R4UKU7 | 29-88 | SNLVVNKTVLAKTDRPAGVVSFTQSKDPNDVLNDWSNHLSTLMQLVNKTTHLINKEEMVH |
| A0A817I5V8 | 32-91 | None |
| B7P9W6 | 269-334 | None |
| A0A2T7PN09 | 805-877 | None |
| A0A7S3S2Y6 | 50-117 | None |
| A0A2U1NT23 | 1083-1142 | None |
| A0A224YQY5 | 121-180 | None |
| A0A821EYB1 | 174-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.