DPCstruct | MC3822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 147 ± 13 aa |
| Standard deviation of domain lengths | 13.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2NC47 | 2-142 | KYVFFLGGQDLEMESIGHLLALKLARFFDKKLAWGAKASSYREEIAAVAKEGANPVLIELEVDIPLPQSAIVVDHHDERSGEKASIL… |
| A0A2C6VBK4 | 2-127 | NYYFLLGGHDLEMLTIRALLEEQRIPFSDRSLPWGASWTDYQDVIELIDQEDQLVVGVELGGAKPSKALLIDHHNEKAHLPSSLEQA… |
| R7F7S0 | 2-160 | None |
| A0A7D8YFG4 | 32-187 | None |
| A0A1I0FUU4 | 160-323 | None |
| A0A1G2VGP0 | 1-143 | None |
| A0A1W1EIB8 | 354-488 | None |
| A0A399HZR1 | 741-893 | None |
| A0A1F5SXR3 | 163-312 | None |
| A0A496VIF5 | 1-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.