DPCstruct | MC38219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 179 |
|---|---|
| Mean domain length (aa) | 213 ± 38 aa |
| Standard deviation of domain lengths | 37.98 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.29 |
| Pfam Score | 98.94 |
| Assigned Pfam label(s) | CL0123- CL0257- CL0453 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G1IWD2 | 11-221 | LEKAQQTFLQKVYQWMAIGLAITGFVAYSVSGNYALMRALSGGTFFILMIAEFGLVMWLSSQAMKLSPSTALTGFLVYSALNGLTFA… |
| A0A446QEN0 | 3-120 | TGKVILEAAILTTVVVFSLTAYTFWAVKRGKDFSFLGPFLFASLIMLLIFGFIQILFPLGKLSHMIYGALAALIFSGYIVYDTDNII… |
| A0A285D4J6 | 23-242 | None |
| L9JF13 | 317-569 | None |
| A0A4V4LNS8 | 34-261 | None |
| A0A177U2T6 | 125-380 | None |
| A0A2C9JXW3 | 181-425 | None |
| A0A6P5VWD9 | 38-275 | None |
| A0A7R9NYX0 | 20-176 | None |
| W5SNQ8 | 699-922 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.