DPCstruct | MC38211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 147 |
|---|---|
| Mean domain length (aa) | 193 ± 32 aa |
| Standard deviation of domain lengths | 32.44 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0766 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0TE25 | 4-200 | IEKTFLKFIENPKFPCIGAKAAAKRKQITFITARDLTSAKDDVLILSKIYQFIEGWKLEKNLLQTLVVIFKAPTELTELEFENNMWT… |
| A0A3D1Y6A1 | 10-185 | VTAAAELTREWVSRLVVGEGLCPFASPVMDTLRIEVSPASDDYTATAEFMTLLQEVADSLPSDLPTALFVVPNLYRDFDEYWNWTLI… |
| K8F3X3 | 63-291 | None |
| H1YHK4 | 9-190 | None |
| A0A7X2IIF4 | 55-274 | None |
| A0A2C9JU22 | 80-340 | None |
| A0A538Q3X7 | 3-180 | None |
| A0A7W7C6Q9 | 1-136 | None |
| A0A7S2UA31 | 93-344 | None |
| A0A517P0J8 | 29-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.