DPCstruct | MC38210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 200 ± 26 aa |
| Standard deviation of domain lengths | 26.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 16.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0SWE6 | 7-173 | KIALSACDHVHEQCPWGSTNRDNSKFFDGREEAIRRLNQTNRDQRLAAIEEKNSEEAKFKIVQLLALIAREAGAGNCQEMAALAFLY… |
| A0A844C5G4 | 31-251 | LSGKYRNQVMNVSPRTMGNLNLASQTQDGVVRYMPHGAGNQWLSVVGSKGESYLRAHLAREDKKAIRDTLRTQAPNMDRTYASGRTA… |
| A0A228PYY5 | 214-430 | None |
| A0A2T4FAZ1 | 144-398 | None |
| G0ADJ9 | 89-331 | None |
| A0A2S9KQA7 | 34-238 | None |
| A0A849HZ03 | 12-221 | None |
| A0A1G8K9V9 | 7-189 | None |
| A0A822JR79 | 56-245 | None |
| A0A2X2SWN5 | 243-445 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.