DPCstruct | MC3821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 79 ± 12 aa |
| Standard deviation of domain lengths | 12.48 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01821 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B3DIY3 | 10-72 | KKHTRDCCLDGMKDSPVSYTCERRSEYILDGQACVDAFLTCCKEMEKQLLEKKEESLQLARSK |
| A0A4X1UM89 | 1-96 | MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCEERAARIKIGPKCVKAFKDCCYIANQVRAEESHKNIQLGRLRKSDIFYQNTRG… |
| G3N8M1 | 1-68 | None |
| A0A3B4DTA4 | 2-78 | None |
| A0A6J0J8J2 | 260-323 | None |
| A0A7J7TAQ3 | 249-333 | None |
| A0A151N059 | 387-489 | None |
| A0A5F5PUU0 | 1-78 | None |
| A0A1V4KK51 | 13-99 | None |
| A0A3B3RZJ7 | 23-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.