DPCstruct | MC38209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 124 ± 10 aa |
| Standard deviation of domain lengths | 10.30 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18840 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0SWA0 | 2-118 | SKPVWVQVRWSESSKFKDNELIPFADFERKAQAVAIHKGRKMQPMEQYCGYYKTKVNVLFDDGNEYECRLDLAPRDTLGFRDHVEQL… |
| A0A416TSZ1 | 78-191 | CKEPTVTITWSECNDFEDGEVIPIAEANKRFELIDADIREQYGGHYYEKTKFLLNYNMGKENFSYEGRQDFGDYEGSLIDHLHNMAL… |
| A0A1I3HAR8 | 16-111 | None |
| A0A7D5UL37 | 23-148 | None |
| A0A1B3X7E1 | 3-132 | None |
| A0A2L1U7K3 | 38-141 | None |
| A0A533SL08 | 1-114 | None |
| A0A368VJA3 | 70-192 | None |
| A0A2U1CC04 | 383-491 | None |
| A0A559KCQ9 | 344-475 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.