DPCstruct | MC38204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 172 ± 28 aa |
| Standard deviation of domain lengths | 27.58 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.54 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0397- CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9XMJ4 | 2-132 | SLPAGAGLHIIQSFEPVPLYAVMADLGFQHETRERDGVFHVYFYKTATLANGEAADVNDAFKTIDARQEDPGSFLPSVITQAQSMQQ… |
| A0A7T9IWD8 | 3-144 | TLDVRPIPPRVRHETIFERLDALATGEALRLVNDHDPAPLRYQLEATRPGHFGWEYVEQGPEVWAIDITSTARVVDARPTLARGDEP… |
| A0A353V6G8 | 202-373 | None |
| A0A7G1G9D0 | 168-309 | None |
| D0LX13 | 13-199 | None |
| A0A1W9VI89 | 1-138 | None |
| A0A3D5DL11 | 231-416 | None |
| A0A1V6DL63 | 20-191 | None |
| A0A2U1WRX9 | 19-200 | None |
| A0A5B7UBB0 | 161-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.