DPCstruct | MC38203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 103 ± 20 aa |
| Standard deviation of domain lengths | 20.13 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 90.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F6SGE9 | 72-190 | MKDPTLVLTIRGRKFTPQFSFKVGSQLLEAHSVQTEVDAGYEGKNQVVLIEAKSSGTANTIIRQLYYPFRQWQEHTAKKVYLLFFEK… |
| A0A7Y5QGA9 | 44-135 | VELDALYAGVDTGGQIYVLPIEAKSRSDHEMIGRVQVAQMVKSARQDFPGFIRRPLAVKMLADDSIGIVEFSDQAEPDALSIHAVRR… |
| A0A0R1W5M3 | 2-125 | None |
| A0A399I411 | 149-297 | None |
| A0A839LW62 | 217-311 | None |
| A0A2V5V5G8 | 427-513 | None |
| A0A4Q6DPX7 | 266-363 | None |
| S9QEJ6 | 107-215 | None |
| A0A564Q6X9 | 1-97 | None |
| A0A7V8BTZ1 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.